(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE59

ALIAD_1.PE59         Location/Qualifiers
FT   CDS             76219..78291
FT                   /locus_tag="Aaci_0060"
FT                   /gene_family="HOG000177796" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:3.2.1.139"
FT                   /codon_start="1"
FT                   /EC_number="3.2.1.139"
FT                   /transl_table="11"
FT                   /note="PFAM: Glycosyl hydrolase 67 middle domain protein;
FT                   glycosyl hydrolase 67 C-teriminal domain protein; KEGG:
FT                   hypothetical protein ; K01235 alpha- glucuronidase"
FT                   /db_xref="GI:258510079"
FT                   /db_xref="InterPro:IPR011099"
FT                   /db_xref="InterPro:IPR011100"
FT                   /db_xref="GeneID:8423522"
FT                   /translation="MTNIPEGDLDYRAWLQESPLPRAVPEAARRMAVYGPADDPLLCTA
FT                   AAEWGRAVRAACGESPARLARDPGGAPSVPCVAMGLLSAMPRGLREAAQAALAGAPSDE
FT                   AYAILPVDGQGVAVVSRTPAGVLYGVFHLIRRLRLGEPLHEPCVSSPKNAWRMLDHWDN
FT                   ADGTIERGYAGKSLFYRGGQIDFDEGRVRDYARLLASVGVNAIAINNVNVHETETRFLT
FT                   EAHLPGVARLADVFRPYGIRVFLSINFASPVDLGDLPTADPLDPRVEDWWRATADRIYR
FT                   HIPDFGGFLVKADSEFRPGPFTYGRDHADGANMLARALAPHGGVVIWRAFVYNCLMDWR
FT                   DRRADRARAAYDHFVPLDGRFLDNVLIQIKNGPMDFQVREPVSPLFGGLSATNVMLEFQ
FT                   ITQEYTGQQRHVCYLAPMWKEVLDFDTHARGPGSTVAEIASGRLFGRPHGGVAGVANVG
FT                   DDVNWTGHSLAQANLYAFGRLAWDPSLDPAGIAREWARLTYGDDPDVVRTVVGILMASW
FT                   PAYEAYTAPLGVGWMVNPGHHDGPNPEGYEYSKWGTYHYADWRGVGVDRTMATGTGYTG
FT                   QYHEPMRSLYEHLETCPDELLLFFHHVPYTHVLHSGKTVIQHIYDAHFDGVEAVAWMIE
FT                   AWRRLQGRIDPVRFERVLARLEDQMQRAVEWRDVINTYFYRKCGIPDARGLHIYP"
FT                   /product="Alpha-glucuronidase"
FT                   /protein_id="YP_003183513.1"
     MTNIPEGDLD YRAWLQESPL PRAVPEAARR MAVYGPADDP LLCTAAAEWG RAVRAACGES        60
     PARLARDPGG APSVPCVAMG LLSAMPRGLR EAAQAALAGA PSDEAYAILP VDGQGVAVVS       120
     RTPAGVLYGV FHLIRRLRLG EPLHEPCVSS PKNAWRMLDH WDNADGTIER GYAGKSLFYR       180
     GGQIDFDEGR VRDYARLLAS VGVNAIAINN VNVHETETRF LTEAHLPGVA RLADVFRPYG       240
     IRVFLSINFA SPVDLGDLPT ADPLDPRVED WWRATADRIY RHIPDFGGFL VKADSEFRPG       300
     PFTYGRDHAD GANMLARALA PHGGVVIWRA FVYNCLMDWR DRRADRARAA YDHFVPLDGR       360
     FLDNVLIQIK NGPMDFQVRE PVSPLFGGLS ATNVMLEFQI TQEYTGQQRH VCYLAPMWKE       420
     VLDFDTHARG PGSTVAEIAS GRLFGRPHGG VAGVANVGDD VNWTGHSLAQ ANLYAFGRLA       480
     WDPSLDPAGI AREWARLTYG DDPDVVRTVV GILMASWPAY EAYTAPLGVG WMVNPGHHDG       540
     PNPEGYEYSK WGTYHYADWR GVGVDRTMAT GTGYTGQYHE PMRSLYEHLE TCPDELLLFF       600
     HHVPYTHVLH SGKTVIQHIY DAHFDGVEAV AWMIEAWRRL QGRIDPVRFE RVLARLEDQM       660
     QRAVEWRDVI NTYFYRKCGI PDARGLHIYP                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page