(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE6

ALIAD_1.PE6          Location/Qualifiers
FT   CDS             6202..8664
FT                   /locus_tag="Aaci_0006"
FT                   /gene_family="HOG000076279" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /codon_start="1"
FT                   /EC_number="5.99.1.3"
FT                   /transl_table="11"
FT                   /note="KEGG: gur:Gura_0005 DNA gyrase, A subunit; TIGRFAM:
FT                   DNA gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller; SMART: DNA
FT                   gyrase/topoisomerase IV subunit A"
FT                   /db_xref="GI:258510026"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="GeneID:8423464"
FT                   /translation="MADESSSRGILPVDISQELRNSFLDYAMSVIVARAIPDVRDGLKP
FT                   VHRRILYAMYEAGMTPDKPYKKSSRIVGDVLGKFHPHGDAAVYEALVRLAQDFSTRYPL
FT                   IDGHGNFGSIDGDAAAAMRYTESRMSAIALELLRDINKETVDFIPNYDEQEEEPVVLPS
FT                   RFPNLLVNGSSGIAVGMATNIPPHNLREVIDGVVMLIDHPDATLDDLMTVIKGPDFPTG
FT                   GVILGREGIRKAYETGRGSITVRAVTHFEELSGGKTRIVVTEIPYQQNKARIVEKIAEL
FT                   AREKKIDGITDLRDESDRRGMRVVIELRRDVRPQVVLNNLFKHTALQTSFGVINLALVN
FT                   GEPKVLTLRETLEHYLNHQRDVVRRRTQYDLAKAEARAHILEGLRIALDHLDEVISLIR
FT                   SSRTVDEARQGLISTFGLSEEQAQAILDMRLQRLTGLEREKIEAEYQELQQRIAELKAI
FT                   LADPKLLDGVIRQEILEIKERFGDERRTRIVNAEGEISEEDLIPVHDVVIAITHRGYIK
FT                   RLPLSTYHSQRRGGRGMTLINAHEEDFVTGLHVTSTHDYLLFFTNRGRMYAIKAYDVPE
FT                   FGRQARGTPIVNLLNIEQGEKVTAMIPVKSLDPAEIGDTYLFFATRQGIVKKTPLAEYS
FT                   NVRKNGLIAINLRDDDDLVGVKLTDGTKEIMMVTRNGLAIRFPETDVRPMGRAATGVKG
FT                   ISLSEGDEVIAMDVAEDDHDVLVVTSRGYGKRTPVSEYRAQSRGGKGIKTLNCTPKNGH
FT                   AIEMCMVTEDDDVMIVTQAGVAIRIHVRDVSTLSRNTQGVRLINVDEGVEVASVSRVVK
FT                   DDDEDSEP"
FT                   /product="DNA gyrase, A subunit"
FT                   /protein_id="YP_003183460.1"
     MADESSSRGI LPVDISQELR NSFLDYAMSV IVARAIPDVR DGLKPVHRRI LYAMYEAGMT        60
     PDKPYKKSSR IVGDVLGKFH PHGDAAVYEA LVRLAQDFST RYPLIDGHGN FGSIDGDAAA       120
     AMRYTESRMS AIALELLRDI NKETVDFIPN YDEQEEEPVV LPSRFPNLLV NGSSGIAVGM       180
     ATNIPPHNLR EVIDGVVMLI DHPDATLDDL MTVIKGPDFP TGGVILGREG IRKAYETGRG       240
     SITVRAVTHF EELSGGKTRI VVTEIPYQQN KARIVEKIAE LAREKKIDGI TDLRDESDRR       300
     GMRVVIELRR DVRPQVVLNN LFKHTALQTS FGVINLALVN GEPKVLTLRE TLEHYLNHQR       360
     DVVRRRTQYD LAKAEARAHI LEGLRIALDH LDEVISLIRS SRTVDEARQG LISTFGLSEE       420
     QAQAILDMRL QRLTGLEREK IEAEYQELQQ RIAELKAILA DPKLLDGVIR QEILEIKERF       480
     GDERRTRIVN AEGEISEEDL IPVHDVVIAI THRGYIKRLP LSTYHSQRRG GRGMTLINAH       540
     EEDFVTGLHV TSTHDYLLFF TNRGRMYAIK AYDVPEFGRQ ARGTPIVNLL NIEQGEKVTA       600
     MIPVKSLDPA EIGDTYLFFA TRQGIVKKTP LAEYSNVRKN GLIAINLRDD DDLVGVKLTD       660
     GTKEIMMVTR NGLAIRFPET DVRPMGRAAT GVKGISLSEG DEVIAMDVAE DDHDVLVVTS       720
     RGYGKRTPVS EYRAQSRGGK GIKTLNCTPK NGHAIEMCMV TEDDDVMIVT QAGVAIRIHV       780
     RDVSTLSRNT QGVRLINVDE GVEVASVSRV VKDDDEDSEP                             820
//

If you have problems or comments...

PBIL Back to PBIL home page