(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE60

ALIAD_1.PE60         Location/Qualifiers
FT   CDS             78354..79016
FT                   /locus_tag="Aaci_0061"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Pnap_4852"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pna:Pnap_4852 hypothetical protein"
FT                   /db_xref="GI:258510080"
FT                   /db_xref="GeneID:8423523"
FT                   /translation="MASSRTRKRLGWVGGAVFLAAALYVVYMAYASFIADPGDVSFLAH
FT                   KTSLHRHLSHGAWLVALHVHVASALVAILAGALNFGWTRARAHPVLHRAVGYLYLAGVL
FT                   GVDGTSGYLAPEATGGEVVTVAFNLLNVYWLVAAFWVYWMARKRRPDAHRRWAVRSYVF
FT                   LDTNALNRGFTWLSVHVAGLPFATAYTMAVCLSIAMNVALGEVLARTLYPCTSARRA"
FT                   /protein_id="YP_003183514.1"
     MASSRTRKRL GWVGGAVFLA AALYVVYMAY ASFIADPGDV SFLAHKTSLH RHLSHGAWLV        60
     ALHVHVASAL VAILAGALNF GWTRARAHPV LHRAVGYLYL AGVLGVDGTS GYLAPEATGG       120
     EVVTVAFNLL NVYWLVAAFW VYWMARKRRP DAHRRWAVRS YVFLDTNALN RGFTWLSVHV       180
     AGLPFATAYT MAVCLSIAMN VALGEVLART LYPCTSARRA                             220
//

If you have problems or comments...

PBIL Back to PBIL home page