(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE61

ALIAD_1.PE61         Location/Qualifiers
FT   CDS             complement(79091..80602)
FT                   /locus_tag="Aaci_0062"
FT                   /gene_family="HOG000262983" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00474"
FT                   /codon_start="1"
FT                   /product="Na+/solute symporter"
FT                   /transl_table="11"
FT                   /note="PFAM: Na+/solute symporter; KEGG: bcm:Bcenmc03_2360
FT                   Na+/solute symporter"
FT                   /db_xref="GI:258510081"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="GeneID:8423524"
FT                   /translation="MQINWTAFSIFIIFFLFVAVLGFVAARWRRGDLSHLEEWGLAGRR
FT                   FGTLITWFLVGGDLYTAYTFIAVPGLMYGKGALGFYAVPYTTVVYPIFLLILPRFWSVA
FT                   RSKGYVTASDFVQGRYGDRLLSFAVALTGIVATIPYIALQLTGMQAVITAMGIPGSWPL
FT                   IIAFIILALFAYTSGLRAPAMIAIVKDLMIYITIIVAVILIPIKLGGFGPIFHASAAAL
FT                   AKHHPPGSIALSPKLYATYGTLALGSALALFLYPHAVTGVFSASSRRVVKRNMALLPAY
FT                   SFALGIIALLGYMALAAGVHTKSTSEAVPLLFLKEFPTWFAGFGFAAIGIGALVPAAIM
FT                   SIASANLFTRNIYKAFFVPNASHENEARVAKIVSLIIILLALVFILGFPQQYAISMQQV
FT                   GGILILQTLPTVVFGLFTRWFHRRGLFLGWLVGIVLGVLMWASTGYQSTSYTVGGVTAY
FT                   AGIWALIVNIVIAVVFSAIFRAMGLSNGEDETSPSDYRVDVEASA"
FT                   /protein_id="YP_003183515.1"
     MQINWTAFSI FIIFFLFVAV LGFVAARWRR GDLSHLEEWG LAGRRFGTLI TWFLVGGDLY        60
     TAYTFIAVPG LMYGKGALGF YAVPYTTVVY PIFLLILPRF WSVARSKGYV TASDFVQGRY       120
     GDRLLSFAVA LTGIVATIPY IALQLTGMQA VITAMGIPGS WPLIIAFIIL ALFAYTSGLR       180
     APAMIAIVKD LMIYITIIVA VILIPIKLGG FGPIFHASAA ALAKHHPPGS IALSPKLYAT       240
     YGTLALGSAL ALFLYPHAVT GVFSASSRRV VKRNMALLPA YSFALGIIAL LGYMALAAGV       300
     HTKSTSEAVP LLFLKEFPTW FAGFGFAAIG IGALVPAAIM SIASANLFTR NIYKAFFVPN       360
     ASHENEARVA KIVSLIIILL ALVFILGFPQ QYAISMQQVG GILILQTLPT VVFGLFTRWF       420
     HRRGLFLGWL VGIVLGVLMW ASTGYQSTSY TVGGVTAYAG IWALIVNIVI AVVFSAIFRA       480
     MGLSNGEDET SPSDYRVDVE ASA                                               503
//

If you have problems or comments...

PBIL Back to PBIL home page