(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE63

ALIAD_1.PE63         Location/Qualifiers
FT   CDS             complement(81071..82765)
FT                   /locus_tag="Aaci_0064"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /codon_start="1"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /transl_table="11"
FT                   /note="KEGG: dma:DMR_19620 sensor protein ZraS; TIGRFAM:
FT                   PAS sensor protein; PFAM: ATP-binding region ATPase domain
FT                   protein; PAS fold domain protein; PAS fold-4 domain
FT                   protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; PAS domain containing protein"
FT                   /db_xref="GI:258510083"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="GeneID:8423526"
FT                   /translation="MNHDFRRAYPYALLAIGLTVPFCAAWGLYGQTQSLLWILIAVACG
FT                   LEFFPLQLPGGRQWSTSVFCYVWAADQFGFWAASTTILFSVIAAFLRSVDGKLTGAHLR
FT                   RLLISLGTHQLALVPAYAALRHALFLPYLIRSALAAVLFELARLTALACFHGSMRRLGA
FT                   AFGALRGLHPAALLIPASLASLLSAHEADWAVTLPTAALFLSFLWLSRAHARLADECES
FT                   ARQTYRVIAENSADLVLIAAPSGEITFASPGFLASAGLSRESLVGRSVFDLVAPEDFAR
FT                   FDELFTPAGADGQEHDVALEIDDVRVNVALRLTLIRSGTHSPSYILQARDLAPRLRREA
FT                   SRLRDERLEAVGQLAASIAHEFRNPLTTVMGFVQLFRSQFDELAPGAYEAIWGELERMK
FT                   DVTDSLMVLARPEAFKPIPCDLAEMARAAIGACEPLALERGVPVDLGPLPPAQVLGHPG
FT                   QLRQMMVHLLRNAIEAAAETRGRVVLWVTSTEAEAIVHIQDTGPGIPDSVLEHLGEPLY
FT                   HTKEKGTGLGLMVVHRIVQQHGGQIHIRRTEAPIGTAVEVRLPISRR"
FT                   /protein_id="YP_003183517.1"
     MNHDFRRAYP YALLAIGLTV PFCAAWGLYG QTQSLLWILI AVACGLEFFP LQLPGGRQWS        60
     TSVFCYVWAA DQFGFWAAST TILFSVIAAF LRSVDGKLTG AHLRRLLISL GTHQLALVPA       120
     YAALRHALFL PYLIRSALAA VLFELARLTA LACFHGSMRR LGAAFGALRG LHPAALLIPA       180
     SLASLLSAHE ADWAVTLPTA ALFLSFLWLS RAHARLADEC ESARQTYRVI AENSADLVLI       240
     AAPSGEITFA SPGFLASAGL SRESLVGRSV FDLVAPEDFA RFDELFTPAG ADGQEHDVAL       300
     EIDDVRVNVA LRLTLIRSGT HSPSYILQAR DLAPRLRREA SRLRDERLEA VGQLAASIAH       360
     EFRNPLTTVM GFVQLFRSQF DELAPGAYEA IWGELERMKD VTDSLMVLAR PEAFKPIPCD       420
     LAEMARAAIG ACEPLALERG VPVDLGPLPP AQVLGHPGQL RQMMVHLLRN AIEAAAETRG       480
     RVVLWVTSTE AEAIVHIQDT GPGIPDSVLE HLGEPLYHTK EKGTGLGLMV VHRIVQQHGG       540
     QIHIRRTEAP IGTAVEVRLP ISRR                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page