(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE65

ALIAD_1.PE65         Location/Qualifiers
FT   CDS             84370..85158
FT                   /locus_tag="Aaci_0066"
FT                   /gene_family="HOG000037640" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03263"
FT                   /codon_start="1"
FT                   /EC_number="2.7.4.8"
FT                   /transl_table="11"
FT                   /note="KEGG: pfs:PFLU5993 guanylate kinase; TIGRFAM:
FT                   guanylate kinase; PFAM: guanylate kinase; SMART: guanylate
FT                   kinase/L-type calcium channel region"
FT                   /db_xref="GI:258510085"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="GeneID:8423528"
FT                   /translation="MSQIRFHLDRLLSERNWKIPDLVKRSGVNKNTLYAMKKNAITRVD
FT                   LRVLERICDALSCKLSDLMTYEPEGETHTKGLLFILSGPSGAGKNTLINALRDRYDLGL
FT                   TFIPSFSTRPMRPGETNGNPYYFVSREEFMRMAERGEFLEYETIHGNLYGTHLLSYERA
FT                   LNEGRIIIKDIDVNGALNMKRVFGDRVILIYVRPTCLDDLEGRLHHRGDKEEDIRIRMQ
FT                   RLKYEESLSDQFDFLIFNDDVATATAELAHIIRTCTRKHA"
FT                   /product="transcriptional regulator, XRE family"
FT                   /protein_id="YP_003183519.1"
     MSQIRFHLDR LLSERNWKIP DLVKRSGVNK NTLYAMKKNA ITRVDLRVLE RICDALSCKL        60
     SDLMTYEPEG ETHTKGLLFI LSGPSGAGKN TLINALRDRY DLGLTFIPSF STRPMRPGET       120
     NGNPYYFVSR EEFMRMAERG EFLEYETIHG NLYGTHLLSY ERALNEGRII IKDIDVNGAL       180
     NMKRVFGDRV ILIYVRPTCL DDLEGRLHHR GDKEEDIRIR MQRLKYEESL SDQFDFLIFN       240
     DDVATATAEL AHIIRTCTRK HA                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page