(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE66

ALIAD_1.PE66         Location/Qualifiers
FT   CDS             85171..87126
FT                   /locus_tag="Aaci_0067"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /codon_start="1"
FT                   /product="histidine kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase HAMP region domain
FT                   protein; histidine kinase A domain protein; KEGG:
FT                   afw:Anae109_0620 integral membrane sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="GI:258510086"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="GeneID:8423529"
FT                   /translation="MQVNAHPRVRFSLRYKIIAILFGAMLVVLALGGTLFYSVARQQML
FT                   KSADKQAQLLAQQIELEVESSEAGQAYIDNLLGNELRIASIAIEKQLPPHWRDVTNEQL
FT                   RQLSAELGVSGITLLAPTADDIVGVRSSDPREIGLSTRGMGKWYIAFRDLLAGRPQAST
FT                   YGTAGKNYWSGPFANAASDPSKVDKWGYYYDGTTDYIIDPFYVQTSIPGYEQVVSVNST
FT                   IRHILATEPDILSIAVLNRTFDEKPIRYSYKGVSWIDIANQPVMYGAYRYADHDLDVRL
FT                   KDRALSTGHMQTALDHVDGTTVMKAFIPESEQGSRYIVEIVMNYRIITAQLGDLLHDMA
FT                   ILGGALLVLTGVLSFVGAELITRPLKRITEAVDEIADRNFAAHVDVARSDEIGVLAAHV
FT                   NEMSEKLVEYLRELTRRERGRGVDYLVMATQALVHELGTPLAAIRQMSELLPRLEPNLG
FT                   EKAREILERMRSASEYANRIARDFTAFLRNGMLTVRRRDVVRLVSDAVGLCSSMAQARH
FT                   VKLSFRNETGHRHVYLDVDEDKLFGAIVNLVRNAIDAIPDDRARREVDVTVRIEAEELH
FT                   IDVIDSGVGIPRDRWDRIFVPYSSTKKGGLGLGLTFCGLIAIAHGGTVGVVQSSPQGTH
FT                   IRMRLPLKHEPIQVDA"
FT                   /protein_id="YP_003183520.1"
     MQVNAHPRVR FSLRYKIIAI LFGAMLVVLA LGGTLFYSVA RQQMLKSADK QAQLLAQQIE        60
     LEVESSEAGQ AYIDNLLGNE LRIASIAIEK QLPPHWRDVT NEQLRQLSAE LGVSGITLLA       120
     PTADDIVGVR SSDPREIGLS TRGMGKWYIA FRDLLAGRPQ ASTYGTAGKN YWSGPFANAA       180
     SDPSKVDKWG YYYDGTTDYI IDPFYVQTSI PGYEQVVSVN STIRHILATE PDILSIAVLN       240
     RTFDEKPIRY SYKGVSWIDI ANQPVMYGAY RYADHDLDVR LKDRALSTGH MQTALDHVDG       300
     TTVMKAFIPE SEQGSRYIVE IVMNYRIITA QLGDLLHDMA ILGGALLVLT GVLSFVGAEL       360
     ITRPLKRITE AVDEIADRNF AAHVDVARSD EIGVLAAHVN EMSEKLVEYL RELTRRERGR       420
     GVDYLVMATQ ALVHELGTPL AAIRQMSELL PRLEPNLGEK AREILERMRS ASEYANRIAR       480
     DFTAFLRNGM LTVRRRDVVR LVSDAVGLCS SMAQARHVKL SFRNETGHRH VYLDVDEDKL       540
     FGAIVNLVRN AIDAIPDDRA RREVDVTVRI EAEELHIDVI DSGVGIPRDR WDRIFVPYSS       600
     TKKGGLGLGL TFCGLIAIAH GGTVGVVQSS PQGTHIRMRL PLKHEPIQVD A                651
//

If you have problems or comments...

PBIL Back to PBIL home page