(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE67

ALIAD_1.PE67         Location/Qualifiers
FT   CDS             complement(87111..88232)
FT                   /locus_tag="Aaci_0068"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01841"
FT                   /codon_start="1"
FT                   /product="transglutaminase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: transglutaminase domain protein; Protein of
FT                   unknown function DUF553; SMART: transglutaminase domain
FT                   protein; KEGG: hypothetical protein"
FT                   /db_xref="GI:258510087"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR007562"
FT                   /db_xref="GeneID:8423530"
FT                   /translation="MNDWLEWVLWAIVAVSALAGFRRGFERESRRLVQTAAFVAEVVAS
FT                   SAAAFAASRSIRNFVLQDSQSASVPSWLAHLAAFWQQSPRLCNWIAFLAAYLVVSSAIG
FT                   ALLAPLGARWIRPRGRMRALSRAGGLVVGGVLGAFRAAAVGACLFLVLQYVSAPALARA
FT                   SQASPAYRWLSHHVYTPWLRPIAEREMPVLAKGAAQTVAADISLFVVPTGPGEETGILV
FT                   VPKPVAEKALAITSGLTSPYAKARALYEWEIDHVHYDWKKYDDYVDDGKWDAQSPLTTL
FT                   ETGKGVCADYALLYADMAHAVGLTVRIDEGVAVTGGVEGSHAWNEVWIPDQHRYILVDP
FT                   TWGSAQDAWFDVPPAVFDETHRLTTRITIYAST"
FT                   /protein_id="YP_003183521.1"
     MNDWLEWVLW AIVAVSALAG FRRGFERESR RLVQTAAFVA EVVASSAAAF AASRSIRNFV        60
     LQDSQSASVP SWLAHLAAFW QQSPRLCNWI AFLAAYLVVS SAIGALLAPL GARWIRPRGR       120
     MRALSRAGGL VVGGVLGAFR AAAVGACLFL VLQYVSAPAL ARASQASPAY RWLSHHVYTP       180
     WLRPIAEREM PVLAKGAAQT VAADISLFVV PTGPGEETGI LVVPKPVAEK ALAITSGLTS       240
     PYAKARALYE WEIDHVHYDW KKYDDYVDDG KWDAQSPLTT LETGKGVCAD YALLYADMAH       300
     AVGLTVRIDE GVAVTGGVEG SHAWNEVWIP DQHRYILVDP TWGSAQDAWF DVPPAVFDET       360
     HRLTTRITIY AST                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page