(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE7

ALIAD_1.PE7          Location/Qualifiers
FT   CDS             8731..8844
FT                   /locus_tag="Aaci_0007"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:258510027"
FT                   /db_xref="GeneID:8423465"
FT                   /translation="MQNAFWDFVVHTSAMFLAFATFVGLCFIVVNAIVKEK"
FT                   /protein_id="YP_003183461.1"
     MQNAFWDFVV HTSAMFLAFA TFVGLCFIVV NAIVKEK                                 37
//

If you have problems or comments...

PBIL Back to PBIL home page