(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE70

ALIAD_1.PE70         Location/Qualifiers
FT   CDS             complement(89934..90287)
FT                   /locus_tag="Aaci_0071"
FT                   /gene_family="HOG000221987" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aav:Aave_1600 hypothetical protein"
FT                   /db_xref="GI:258510090"
FT                   /db_xref="GeneID:8423533"
FT                   /translation="MKCIYLSGPMTGLPHGNRPAFLEAAQSLRARGFRVINPAEYGSPE
FT                   DDWYAAMRRDIRMLMDADAVVTLPGWERSRGARLEVYVACQLNMPVYTLTACLRAAEED
FT                   LAKAPAIQLSLEL"
FT                   /protein_id="YP_003183524.1"
     MKCIYLSGPM TGLPHGNRPA FLEAAQSLRA RGFRVINPAE YGSPEDDWYA AMRRDIRMLM        60
     DADAVVTLPG WERSRGARLE VYVACQLNMP VYTLTACLRA AEEDLAKAPA IQLSLEL          117
//

If you have problems or comments...

PBIL Back to PBIL home page