(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE73

ALIAD_1.PE73         Location/Qualifiers
FT   CDS             complement(93316..94089)
FT                   /locus_tag="Aaci_0074"
FT                   /gene_family="HOG000004695" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /codon_start="1"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /transl_table="11"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: rle:pRL120015 putative glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="GI:258510093"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="GeneID:8423536"
FT                   /translation="MIRELLMRDDTLFIAHRGASAECPENTLPAFVRAAELGADMIELD
FT                   VRLTGDGGVVVLHDPTVDRTTNGSGLAADMRLADLRKLDAGSWFDARFRGTLIPTLDEV
FT                   FATVPHMCLNIELKTSPVAHTRQLIRRVLGAIYRHNARDRVLISSFDHAALAEVRRFDR
FT                   DIAIGVLFTGRLLEPIQLAERLGAQSLHPDIEHLDPLFVAEAKSHHLAVYAWTAKSELA
FT                   VNRALACQVSGIILDDLRLRQIATKAVPSPTPPSA"
FT                   /protein_id="YP_003183527.1"
     MIRELLMRDD TLFIAHRGAS AECPENTLPA FVRAAELGAD MIELDVRLTG DGGVVVLHDP        60
     TVDRTTNGSG LAADMRLADL RKLDAGSWFD ARFRGTLIPT LDEVFATVPH MCLNIELKTS       120
     PVAHTRQLIR RVLGAIYRHN ARDRVLISSF DHAALAEVRR FDRDIAIGVL FTGRLLEPIQ       180
     LAERLGAQSL HPDIEHLDPL FVAEAKSHHL AVYAWTAKSE LAVNRALACQ VSGIILDDLR       240
     LRQIATKAVP SPTPPSA                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page