(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE74

ALIAD_1.PE74         Location/Qualifiers
FT   CDS             complement(94121..95446)
FT                   /locus_tag="Aaci_0075"
FT                   /gene_family="HOG000227636" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /transl_table="11"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: kpu:KP1_0565 putative sn-glycerol-3-phosphate-
FT                   binding periplasmic protein"
FT                   /db_xref="GI:258510094"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="GeneID:8423537"
FT                   /translation="MKRDRLWKSGALLALGLVATGCGAPAANGGGQAATGASRAAASSQ
FT                   PVTITFWYGVGTTLSQDIQQMVQAFNQTHPGIKVVATYQGSYSGGGEEQQKLLAAIKAG
FT                   DPPTIAQIEVHAMPVFAASGQLLDLTNLMQSSSVDKPSNFLPGILVSTQYQGRYYAVPF
FT                   NRSVPVLYYNKTLFAKAHIASPPSNWAQLAADAKKLTSGAGSNKIYGFEPLVDWWPWEY
FT                   AVESGGGSILSPDLKRATFDQPPALSILETEQSLVKQGYAKVETGPNYWDLMTQDFING
FT                   QVAMDIDSIGSAGKVTKGVGDKFQWGTALLPRGKTLAVPPGGGDLAIFKDATPAQQKAA
FT                   WTFIQWWTAPKQSVQWSTETGYLPVQKADLNDPVYQAYLEKHPQYRTAIEELQYEHPSP
FT                   ASPAYLAVLQPVQQALQGIFDEGKPVAATMHQAAEAADQNLG"
FT                   /protein_id="YP_003183528.1"
     MKRDRLWKSG ALLALGLVAT GCGAPAANGG GQAATGASRA AASSQPVTIT FWYGVGTTLS        60
     QDIQQMVQAF NQTHPGIKVV ATYQGSYSGG GEEQQKLLAA IKAGDPPTIA QIEVHAMPVF       120
     AASGQLLDLT NLMQSSSVDK PSNFLPGILV STQYQGRYYA VPFNRSVPVL YYNKTLFAKA       180
     HIASPPSNWA QLAADAKKLT SGAGSNKIYG FEPLVDWWPW EYAVESGGGS ILSPDLKRAT       240
     FDQPPALSIL ETEQSLVKQG YAKVETGPNY WDLMTQDFIN GQVAMDIDSI GSAGKVTKGV       300
     GDKFQWGTAL LPRGKTLAVP PGGGDLAIFK DATPAQQKAA WTFIQWWTAP KQSVQWSTET       360
     GYLPVQKADL NDPVYQAYLE KHPQYRTAIE ELQYEHPSPA SPAYLAVLQP VQQALQGIFD       420
     EGKPVAATMH QAAEAADQNL G                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page