(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE75

ALIAD_1.PE75         Location/Qualifiers
FT   CDS             complement(95489..96316)
FT                   /locus_tag="Aaci_0076"
FT                   /gene_family="HOG000220525" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rpb:RPB_0175
FT                   binding-protein dependent transport system inner membrane
FT                   protein"
FT                   /db_xref="GI:258510095"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:8423538"
FT                   /translation="MKANPVLKIASYALLTIAAALCLAPVYWMIRTSLMPTNDLLSSAL
FT                   WPAHPAWSNFAAAWRAQPFLLYLWNSVFTNGAIVALQVITSSLAAYALVFIPLRGKRWL
FT                   FFAVLVAMMVPMQATFVPVYTMLSAVHLINTYGALILPYAGSAFGIFLMRQGFLTLPRD
FT                   IVDAARVDGASEWWILTRIVLPNNKPTIVTLVLLNFVYHYNSLFWPLVATNTTNMRVVP
FT                   VALSYFLTQDAGQTLQWNYAMAFDIFAIAPVVILFLIGQRYFVQGVAQTAVKG"
FT                   /protein_id="YP_003183529.1"
     MKANPVLKIA SYALLTIAAA LCLAPVYWMI RTSLMPTNDL LSSALWPAHP AWSNFAAAWR        60
     AQPFLLYLWN SVFTNGAIVA LQVITSSLAA YALVFIPLRG KRWLFFAVLV AMMVPMQATF       120
     VPVYTMLSAV HLINTYGALI LPYAGSAFGI FLMRQGFLTL PRDIVDAARV DGASEWWILT       180
     RIVLPNNKPT IVTLVLLNFV YHYNSLFWPL VATNTTNMRV VPVALSYFLT QDAGQTLQWN       240
     YAMAFDIFAI APVVILFLIG QRYFVQGVAQ TAVKG                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page