(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE77

ALIAD_1.PE77         Location/Qualifiers
FT   CDS             97441..98682
FT                   /locus_tag="Aaci_0078"
FT                   /gene_family="HOG000023469" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02073"
FT                   /codon_start="1"
FT                   /product="peptidase M29 aminopeptidase II"
FT                   /transl_table="11"
FT                   /note="PFAM: peptidase M29 aminopeptidase II; KEGG:
FT                   bhe:BH02500 aminopeptidase"
FT                   /db_xref="GI:258510097"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="GeneID:8423540"
FT                   /translation="MIEQMRKYAELVVRVGVNLQPGQPLVIGFGSRQVYPDQVPFARLL
FT                   AQAAYDAGASYVHIDWGDEWWLRETVKRADLAILRQCAQWQVEWVERLAEMGAAYVAMP
FT                   ASDPALFAGIPRDRVEQAERAVREAFRLFDNQRTSDRYRWTLASAPTQAWADAVHPELP
FT                   REDRLEALWRDILQASRATGEDPIADWEQHIANLKRRAAWLNDLKIHALHYRAPGTDLT
FT                   IELAEGHYFEAAGHPDVKGFRFVANIPTEEVFTAPKKTGVNGTVASTMPLNHGGSLIEG
FT                   IRLRFENGRIVEYSAEKGEEALKAIIEADEGSHYLGEVALVPVDSPIAQMNRIFYNTLF
FT                   DENASCHLAIGRAYPLIEGGHELAHEDWEAHGLNDSLMHVDFMIGSADLDIDAVLQDGR
FT                   TVPIFRKGRWASEA"
FT                   /protein_id="YP_003183531.1"
     MIEQMRKYAE LVVRVGVNLQ PGQPLVIGFG SRQVYPDQVP FARLLAQAAY DAGASYVHID        60
     WGDEWWLRET VKRADLAILR QCAQWQVEWV ERLAEMGAAY VAMPASDPAL FAGIPRDRVE       120
     QAERAVREAF RLFDNQRTSD RYRWTLASAP TQAWADAVHP ELPREDRLEA LWRDILQASR       180
     ATGEDPIADW EQHIANLKRR AAWLNDLKIH ALHYRAPGTD LTIELAEGHY FEAAGHPDVK       240
     GFRFVANIPT EEVFTAPKKT GVNGTVASTM PLNHGGSLIE GIRLRFENGR IVEYSAEKGE       300
     EALKAIIEAD EGSHYLGEVA LVPVDSPIAQ MNRIFYNTLF DENASCHLAI GRAYPLIEGG       360
     HELAHEDWEA HGLNDSLMHV DFMIGSADLD IDAVLQDGRT VPIFRKGRWA SEA              413
//

If you have problems or comments...

PBIL Back to PBIL home page