(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE78

ALIAD_1.PE78         Location/Qualifiers
FT   CDS             98712..100328
FT                   /locus_tag="Aaci_0079"
FT                   /gene_family="HOG000175618" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:2.3.2.2"
FT                   /codon_start="1"
FT                   /EC_number="2.3.2.2"
FT                   /transl_table="11"
FT                   /note="PFAM: gamma-glutamyltranspeptidase; KEGG:
FT                   csa:Csal_1740 gamma-glutamyltransferase"
FT                   /db_xref="GI:258510098"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="GeneID:8423541"
FT                   /translation="MVKPHWDATQYEFESRRTVVFARRGMVATTQPLASEAGLEVLRRG
FT                   GNAIDAVVAAAAALAIVEPTSNGIGSDAFAIVWKDGKLHGLNASGHSPERLTRDELERR
FT                   GLRELPTHGWLPVTVPGAPAAWAALVERFGRLSLKDVLAPAVDLARDGFPVQPVTARNW
FT                   RRAMEAHRDRLTDPVHEPFFRLFAPGGEVPGPGDLFRNPDGARALEAIASSGGRAFYEG
FT                   EIADAIDAFARETGGLLSKADLAAYKPEWVEPLSVRYRDFEVWELPPNGQGIVALMALG
FT                   ALAGMDLASMDEADRAHAMLEAIKLAFEVALREVADPRFMRVTPASLLSKDHLDALRAK
FT                   IGDEAHLPAVERPYYGGTVYLCAADGEGNMVSYIQSNYMGFGSGIVVPGTGVSLQNRGH
FT                   NFSMDPSHPNALGPRKRPYHTIIPGFLTRGGEPVGPFGVMGGFMQPQGHVQVLVQMLDL
FT                   ARNPQSALDAPRWQWLQGKRVLAEAALGEDVIAKLRARGHEVDVTDDGTPFGRGQVIWR
FT                   LPNGALAGATEPRADGSIAAW"
FT                   /product="Gamma-glutamyltransferase"
FT                   /protein_id="YP_003183532.1"
     MVKPHWDATQ YEFESRRTVV FARRGMVATT QPLASEAGLE VLRRGGNAID AVVAAAAALA        60
     IVEPTSNGIG SDAFAIVWKD GKLHGLNASG HSPERLTRDE LERRGLRELP THGWLPVTVP       120
     GAPAAWAALV ERFGRLSLKD VLAPAVDLAR DGFPVQPVTA RNWRRAMEAH RDRLTDPVHE       180
     PFFRLFAPGG EVPGPGDLFR NPDGARALEA IASSGGRAFY EGEIADAIDA FARETGGLLS       240
     KADLAAYKPE WVEPLSVRYR DFEVWELPPN GQGIVALMAL GALAGMDLAS MDEADRAHAM       300
     LEAIKLAFEV ALREVADPRF MRVTPASLLS KDHLDALRAK IGDEAHLPAV ERPYYGGTVY       360
     LCAADGEGNM VSYIQSNYMG FGSGIVVPGT GVSLQNRGHN FSMDPSHPNA LGPRKRPYHT       420
     IIPGFLTRGG EPVGPFGVMG GFMQPQGHVQ VLVQMLDLAR NPQSALDAPR WQWLQGKRVL       480
     AEAALGEDVI AKLRARGHEV DVTDDGTPFG RGQVIWRLPN GALAGATEPR ADGSIAAW         538
//

If you have problems or comments...

PBIL Back to PBIL home page