(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE8

ALIAD_1.PE8          Location/Qualifiers
FT   CDS             8883..9671
FT                   /locus_tag="Aaci_0008"
FT                   /gene_family="HOG000060394" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /codon_start="1"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   acetyltransferase, GNAT family-related protein"
FT                   /db_xref="GI:258510028"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="GeneID:8423466"
FT                   /translation="MFRRLTASDHDRVVAYLSKRPALHTFLTGDIERYGYDAPFQEVYG
FT                   YLSDGRVTAVLLRFYGSYIFSTEGPEGVEDVVRMLQSNTAWSMVQGDSVSLSLLQDVGG
FT                   FQPRQVREFAFAERPPHAPRPFVDTAGVYQATVDHVGQLWQLRKSIAEFANSNTTELSL
FT                   RQSFESGDTLCFYVPGERGEMAASASAVAENTWTAMVVGVCTRPLYRGLGYATRCVAKL
FT                   CDVFDERGKTLCLYYDNPNAGGIYRRLGFAVTSGWTQFFR"
FT                   /protein_id="YP_003183462.1"
     MFRRLTASDH DRVVAYLSKR PALHTFLTGD IERYGYDAPF QEVYGYLSDG RVTAVLLRFY        60
     GSYIFSTEGP EGVEDVVRML QSNTAWSMVQ GDSVSLSLLQ DVGGFQPRQV REFAFAERPP       120
     HAPRPFVDTA GVYQATVDHV GQLWQLRKSI AEFANSNTTE LSLRQSFESG DTLCFYVPGE       180
     RGEMAASASA VAENTWTAMV VGVCTRPLYR GLGYATRCVA KLCDVFDERG KTLCLYYDNP       240
     NAGGIYRRLG FAVTSGWTQF FR                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page