(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE80

ALIAD_1.PE80         Location/Qualifiers
FT   CDS             101198..101806
FT                   /locus_tag="Aaci_0081"
FT                   /gene_family="HOG000085119" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, TetR family"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein TetR; KEGG: dal:Dalk_1395
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="GI:258510100"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="GeneID:8423543"
FT                   /translation="MRDRIEEAAKRAFSEFGYKGTTMDQIARLAGVSKGAIYLHFPSKE
FT                   ALFQHMLRGVIAQVRDAFESAQVEGDDYFRNLERGLRALMRFRADHAMLSKLVQEVRQF
FT                   GTAEARAGLGELEAAILDYLARHLKRGVELGVVRPCRANLVAFVLLRAYTAVLRDFPSA
FT                   EGPLSEEDLYQLFTGVFVDGLRLRPGEGEPRNTQSEQER"
FT                   /protein_id="YP_003183534.1"
     MRDRIEEAAK RAFSEFGYKG TTMDQIARLA GVSKGAIYLH FPSKEALFQH MLRGVIAQVR        60
     DAFESAQVEG DDYFRNLERG LRALMRFRAD HAMLSKLVQE VRQFGTAEAR AGLGELEAAI       120
     LDYLARHLKR GVELGVVRPC RANLVAFVLL RAYTAVLRDF PSAEGPLSEE DLYQLFTGVF       180
     VDGLRLRPGE GEPRNTQSEQ ER                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page