(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE82

ALIAD_1.PE82         Location/Qualifiers
FT   CDS             104303..106660
FT                   /locus_tag="Aaci_0083"
FT                   /gene_family="HOG000040246" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Mlg_1110"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aeh:Mlg_1110 hypothetical protein"
FT                   /db_xref="GI:258510102"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="GeneID:8423545"
FT                   /translation="MEGQPSARHPDWESEQAYVDRVVAAMRAKLAELEGVLRGVRGEIV
FT                   EFRRHFWDDVTINLSTLDDLVETHFAIRQQAEVLGERERRYQQAAKTKRTLERQISSPF
FT                   FARIDFRYEGEREAEPIYIGIASFRDERDQTFLVHDWRAPISSVYYDALPGPASFKAPA
FT                   GIVRGELTLKRQFVIRGGAILAMFDAGLTIGDELLMYALSRRSDAQMHNIVATIQRQQN
FT                   VVIRDDESPALLVTGAAGSGKTSAALQRAAYLLYKHRGDLDARQMLFFSPNPLFMSYIS
FT                   NVLPELGEDNIEQATFYDYLCARLQDEFVVEDPFDQMERLLEAGEDSRMARAVRYKASK
FT                   AFADEIDRYVAGLAPQMRFHPILVEGRVIATATDVKAAFDRTDPGLRLPLRVDLVKEEL
FT                   LNRLRQFERDEALSDWVQKAVDGLPDEAYRRAERTAAKRKRERPDLDEQEEARRLLGRE
FT                   VLRRMLRPVRRFVETLRFVDTAGMYRAWFEQAASSPPEGFQSEDWAQICRQTVREMDEG
FT                   TLWYEDATPYLYMKEQILGRAVSAPIRHVLVDEVQDYSVLQLRLIRSLFPYSRITMLGD
FT                   PEQLVSPHRPGILEEDEMARLFPGLVRVAFGQSYRSTRQIVLFTRGMVPKGAEIQPFDR
FT                   DGALPRLAEVSGEAQQAGVIARWLGEFADAGYQTTAVLTKTQAEAERLAKALERLGVKL
FT                   RRLDKRAVSLEPGVVVAPVYLAKGVEFDGVIVANVSREQYQTALDRQLLYTACTRAMHE
FT                   LRMVSVGEASPWILSQPADTYERVDAAEVNAT"
FT                   /protein_id="YP_003183536.1"
     MEGQPSARHP DWESEQAYVD RVVAAMRAKL AELEGVLRGV RGEIVEFRRH FWDDVTINLS        60
     TLDDLVETHF AIRQQAEVLG ERERRYQQAA KTKRTLERQI SSPFFARIDF RYEGEREAEP       120
     IYIGIASFRD ERDQTFLVHD WRAPISSVYY DALPGPASFK APAGIVRGEL TLKRQFVIRG       180
     GAILAMFDAG LTIGDELLMY ALSRRSDAQM HNIVATIQRQ QNVVIRDDES PALLVTGAAG       240
     SGKTSAALQR AAYLLYKHRG DLDARQMLFF SPNPLFMSYI SNVLPELGED NIEQATFYDY       300
     LCARLQDEFV VEDPFDQMER LLEAGEDSRM ARAVRYKASK AFADEIDRYV AGLAPQMRFH       360
     PILVEGRVIA TATDVKAAFD RTDPGLRLPL RVDLVKEELL NRLRQFERDE ALSDWVQKAV       420
     DGLPDEAYRR AERTAAKRKR ERPDLDEQEE ARRLLGREVL RRMLRPVRRF VETLRFVDTA       480
     GMYRAWFEQA ASSPPEGFQS EDWAQICRQT VREMDEGTLW YEDATPYLYM KEQILGRAVS       540
     APIRHVLVDE VQDYSVLQLR LIRSLFPYSR ITMLGDPEQL VSPHRPGILE EDEMARLFPG       600
     LVRVAFGQSY RSTRQIVLFT RGMVPKGAEI QPFDRDGALP RLAEVSGEAQ QAGVIARWLG       660
     EFADAGYQTT AVLTKTQAEA ERLAKALERL GVKLRRLDKR AVSLEPGVVV APVYLAKGVE       720
     FDGVIVANVS REQYQTALDR QLLYTACTRA MHELRMVSVG EASPWILSQP ADTYERVDAA       780
     EVNAT                                                                   785
//

If you have problems or comments...

PBIL Back to PBIL home page