(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE83

ALIAD_1.PE83         Location/Qualifiers
FT   CDS             106657..107280
FT                   /locus_tag="Aaci_0084"
FT                   /gene_family="HOG000221683" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /codon_start="1"
FT                   /product="Phosphoglycerate mutase"
FT                   /transl_table="11"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: pca:Pcar_2741
FT                   phosphoglycerate mutase/fructose-2,6-bisphosphatase"
FT                   /db_xref="GI:258510103"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="GeneID:8423546"
FT                   /translation="MKIYLFRHGQTVYNADGERFCGTSDVGLTALGWQQARRAARLIRG
FT                   VRPAAIVHSGLRRSLETAMAIRESLPGAADCPLVAHEGFREVGFGAWEGLTRAEVNRLY
FT                   PELYAEWLARPEEARIPGGDDLYERQQEAVDAFLDVVARYRDGDLVIVAHNTLNRLLIL
FT                   GLMGLDARHYRRIVQENACLNILEYHEEEGVRLHALNRVPEQDE"
FT                   /protein_id="YP_003183537.1"
     MKIYLFRHGQ TVYNADGERF CGTSDVGLTA LGWQQARRAA RLIRGVRPAA IVHSGLRRSL        60
     ETAMAIRESL PGAADCPLVA HEGFREVGFG AWEGLTRAEV NRLYPELYAE WLARPEEARI       120
     PGGDDLYERQ QEAVDAFLDV VARYRDGDLV IVAHNTLNRL LILGLMGLDA RHYRRIVQEN       180
     ACLNILEYHE EEGVRLHALN RVPEQDE                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page