(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE84

ALIAD_1.PE84         Location/Qualifiers
FT   CDS             107356..108630
FT                   /locus_tag="Aaci_0085"
FT                   /gene_family="HOG000100403" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:5.3.1.9"
FT                   /codon_start="1"
FT                   /EC_number="5.3.1.9"
FT                   /transl_table="11"
FT                   /note="PFAM: phosphoglucose isomerase (PGI); KEGG:
FT                   dds:Ddes_0851 glucose-6-phosphate isomerase"
FT                   /db_xref="GI:258510104"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="GeneID:8423547"
FT                   /translation="MIELSLEKARKWFTEEHEARLAPLAQFALGELNNRDRDAFGKGWI
FT                   DWPAADHSALYRDVDAIAADFRAKSNATVVIGIGGSYLGAQSALSMAKPAFTGEGHHEV
FT                   IFAGQQLSPTYHAHLLQYLDKREVTLVVVSKSGTTLEPSAVFHTFREYLEKRYGVEEAN
FT                   RRICAITDAEKGSLRQFADERKYATLPIPDDIGGRYSVLTAVGLLPMALAGIDYKRVMQ
FT                   GAARMREELSKLKVADHPAVKYALARHVLYQQGFVAEALVTYEPRVADFAGWWQQLFGE
FT                   SQGKDGTGLFPTMLRYTTDLHSMGQYVQDARKILVETVLDVHFSDEPELVVPRGLDEKN
FT                   AYLDGVSFSRLQEVAVESVMVAHSEAGVPNILIRAKGDPESLYGELVYFFEVACAVGGY
FT                   LMGTNPFDQPGVEAYKNEMRSRLKA"
FT                   /product="Glucose-6-phosphate isomerase"
FT                   /protein_id="YP_003183538.1"
     MIELSLEKAR KWFTEEHEAR LAPLAQFALG ELNNRDRDAF GKGWIDWPAA DHSALYRDVD        60
     AIAADFRAKS NATVVIGIGG SYLGAQSALS MAKPAFTGEG HHEVIFAGQQ LSPTYHAHLL       120
     QYLDKREVTL VVVSKSGTTL EPSAVFHTFR EYLEKRYGVE EANRRICAIT DAEKGSLRQF       180
     ADERKYATLP IPDDIGGRYS VLTAVGLLPM ALAGIDYKRV MQGAARMREE LSKLKVADHP       240
     AVKYALARHV LYQQGFVAEA LVTYEPRVAD FAGWWQQLFG ESQGKDGTGL FPTMLRYTTD       300
     LHSMGQYVQD ARKILVETVL DVHFSDEPEL VVPRGLDEKN AYLDGVSFSR LQEVAVESVM       360
     VAHSEAGVPN ILIRAKGDPE SLYGELVYFF EVACAVGGYL MGTNPFDQPG VEAYKNEMRS       420
     RLKA                                                                    424
//

If you have problems or comments...

PBIL Back to PBIL home page