(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE85

ALIAD_1.PE85         Location/Qualifiers
FT   CDS             108654..109595
FT                   /locus_tag="Aaci_0086"
FT                   /gene_family="HOG000150087" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00744"
FT                   /codon_start="1"
FT                   /product="glucokinase, ROK family"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: glucokinase, ROK family; PFAM: ROK family
FT                   protein; KEGG: mlo:mlr7234 glucose kinase"
FT                   /db_xref="GI:258510105"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR004654"
FT                   /db_xref="GeneID:8423548"
FT                   /translation="MEQKLALGIDIGGTNVKLAIVRSDGRVLVDRSIPTAPERGPEAFS
FT                   RTVGAEARAMANEASVAWDSVVGAGVGMAGFLDVERGWVEEAVNLHWRDVPLADLLQSA
FT                   LDKPVRVDNDANVAALGEVWLGAGQNAHTALCVTLGTGVGGGIVIGGRIHRGASTMAGE
FT                   IGHIMVKNDGELCNCGHRGCLETLASATALVRHAVAAGVKSPGGGELTAKEVFALAAEG
FT                   DPAARAVVDDMIHWLAVGLAVVANILNPDVIVVAGGLVNAGDQLMEPLRAAFQREALAR
FT                   VARACRLVPAKLGDQAGVLGAARLVLQDIESL"
FT                   /protein_id="YP_003183539.1"
     MEQKLALGID IGGTNVKLAI VRSDGRVLVD RSIPTAPERG PEAFSRTVGA EARAMANEAS        60
     VAWDSVVGAG VGMAGFLDVE RGWVEEAVNL HWRDVPLADL LQSALDKPVR VDNDANVAAL       120
     GEVWLGAGQN AHTALCVTLG TGVGGGIVIG GRIHRGASTM AGEIGHIMVK NDGELCNCGH       180
     RGCLETLASA TALVRHAVAA GVKSPGGGEL TAKEVFALAA EGDPAARAVV DDMIHWLAVG       240
     LAVVANILNP DVIVVAGGLV NAGDQLMEPL RAAFQREALA RVARACRLVP AKLGDQAGVL       300
     GAARLVLQDI ESL                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page