(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE86

ALIAD_1.PE86         Location/Qualifiers
FT   CDS             complement(109643..109882)
FT                   /locus_tag="Aaci_0087"
FT                   /gene_family="HOG000245309" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03698"
FT                   /codon_start="1"
FT                   /product="protein of unknown function UPF0180"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function UPF0180"
FT                   /db_xref="GI:258510106"
FT                   /db_xref="InterPro:IPR005370"
FT                   /db_xref="GeneID:8423549"
FT                   /translation="MKAVAVEPGLTPVKEYLQSQGCQVVDMSSHMEPSVGAVVITGLDK
FT                   NLMGMQSAIQQVPVISADGLSPEAVYDRVKDYLR"
FT                   /protein_id="YP_003183540.1"
     MKAVAVEPGL TPVKEYLQSQ GCQVVDMSSH MEPSVGAVVI TGLDKNLMGM QSAIQQVPVI        60
     SADGLSPEAV YDRVKDYLR                                                     79
//

If you have problems or comments...

PBIL Back to PBIL home page