(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE87

ALIAD_1.PE87         Location/Qualifiers
FT   CDS             109981..110310
FT                   /locus_tag="Aaci_0088"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:258510107"
FT                   /db_xref="GeneID:8423550"
FT                   /translation="MGHVHMIFGVILIILAILATAWEIAAQRGLPRALRGVVIGLFDLQ
FT                   VLLGIITWIVRRPNWSFVFHPIIMIVAVIILHVMTSPSATRSRRLTGWIVATVLFIIGA
FT                   AIYHA"
FT                   /protein_id="YP_003183541.1"
     MGHVHMIFGV ILIILAILAT AWEIAAQRGL PRALRGVVIG LFDLQVLLGI ITWIVRRPNW        60
     SFVFHPIIMI VAVIILHVMT SPSATRSRRL TGWIVATVLF IIGAAIYHA                   109
//

If you have problems or comments...

PBIL Back to PBIL home page