(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE88

ALIAD_1.PE88         Location/Qualifiers
FT   CDS             110452..110766
FT                   /locus_tag="Aaci_0089"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:258510108"
FT                   /db_xref="GeneID:8423551"
FT                   /translation="MADRLQLQIRYPEQGLTERERQLVVCLVQRICVHHLQRRRDRSVH
FT                   IRPANVDSIHLLVNEVIEVEPALADDERGEILRALVEDVNRTLALCGIRGEDIVRVHLA
FT                   "
FT                   /protein_id="YP_003183542.1"
     MADRLQLQIR YPEQGLTERE RQLVVCLVQR ICVHHLQRRR DRSVHIRPAN VDSIHLLVNE        60
     VIEVEPALAD DERGEILRAL VEDVNRTLAL CGIRGEDIVR VHLA                        104
//

If you have problems or comments...

PBIL Back to PBIL home page