(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE90

ALIAD_1.PE90         Location/Qualifiers
FT   CDS             complement(111332..113470)
FT                   /locus_tag="Aaci_0091"
FT                   /gene_family="HOG000072128" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03176"
FT                   /codon_start="1"
FT                   /product="MMPL domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: MMPL domain protein; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="GI:258510110"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="GeneID:8423555"
FT                   /translation="MHRFEPKVRTWSRTWRAAAILGWLLAAALLAAVFPAASKEEINRS
FT                   TLLPASAPSQMATARVRDAFPASSGTPAILVFYDPTGISSADWAAIRRTVRELRTHPVT
FT                   AQTQVPPLDALPSGAAARFASDDGKVVSFPVLLRADASQDQLNQAVDEIDQDLRRAVGA
FT                   GALNLALDRPGLHAYVTGPAGIAVDATHLFQHADLALLIATTLLVLALMIVLYRSPILA
FT                   LVPLVSVGIAYAVVSSLLGAWARYGGLTFDAQTLSILTVLLFGAGTDYCLFLIARYRQE
FT                   LRRHERPIDALRAGYKSAAGAILMSGLTVSASLLSLLAARSPSFHEFAIPFSVAVFVMA
FT                   LVAITFVPALIGSLGRAAFWPRIPRYEPDAPDAGRPGRVSRWLGRTAVRRRKPVAVLGS
FT                   LALAACCLALPHVRTSYDLLSSFPADMPSREGYAVLSAHESPGALAPIDVLVEGGSPEG
FT                   AVRAVQSLAAVEQVHLVAVRDHAHVALMQVELRTNPYSETAMAALSSIERAAAKGASAG
FT                   GQAAHVFLAGETAAQEDTRAITARDTRVVIPIVLVAIGLLLLVYLRSVVAPLYLLATIV
FT                   LSYGAAMGLGWLVIREVLHQPAMQGAIPLYAFVFLVALGEDYNIFVMSRIWEVWRRGQA
FT                   DAAVERGVADTASVITSAGLILAGTFAMLASLPIQVLLQFGVVTAIGVLLDTFVVRPWM
FT                   VPAITALLGDAARWPRRT"
FT                   /protein_id="YP_003183544.1"
     MHRFEPKVRT WSRTWRAAAI LGWLLAAALL AAVFPAASKE EINRSTLLPA SAPSQMATAR        60
     VRDAFPASSG TPAILVFYDP TGISSADWAA IRRTVRELRT HPVTAQTQVP PLDALPSGAA       120
     ARFASDDGKV VSFPVLLRAD ASQDQLNQAV DEIDQDLRRA VGAGALNLAL DRPGLHAYVT       180
     GPAGIAVDAT HLFQHADLAL LIATTLLVLA LMIVLYRSPI LALVPLVSVG IAYAVVSSLL       240
     GAWARYGGLT FDAQTLSILT VLLFGAGTDY CLFLIARYRQ ELRRHERPID ALRAGYKSAA       300
     GAILMSGLTV SASLLSLLAA RSPSFHEFAI PFSVAVFVMA LVAITFVPAL IGSLGRAAFW       360
     PRIPRYEPDA PDAGRPGRVS RWLGRTAVRR RKPVAVLGSL ALAACCLALP HVRTSYDLLS       420
     SFPADMPSRE GYAVLSAHES PGALAPIDVL VEGGSPEGAV RAVQSLAAVE QVHLVAVRDH       480
     AHVALMQVEL RTNPYSETAM AALSSIERAA AKGASAGGQA AHVFLAGETA AQEDTRAITA       540
     RDTRVVIPIV LVAIGLLLLV YLRSVVAPLY LLATIVLSYG AAMGLGWLVI REVLHQPAMQ       600
     GAIPLYAFVF LVALGEDYNI FVMSRIWEVW RRGQADAAVE RGVADTASVI TSAGLILAGT       660
     FAMLASLPIQ VLLQFGVVTA IGVLLDTFVV RPWMVPAITA LLGDAARWPR RT               712
//

If you have problems or comments...

PBIL Back to PBIL home page