(data stored in ACNUC7421 zone)

HOGENOMDNA: ALIAD_1.PE94

ALIAD_1.PE94         Location/Qualifiers
FT   CDS             complement(115223..116308)
FT                   /locus_tag="Aaci_0095"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: scl:sce4410 hypothetical protein"
FT                   /db_xref="GI:258510114"
FT                   /db_xref="GeneID:8423559"
FT                   /translation="MKDRTEGARRARDAHERASWKRNWSTWLGLCSTMAIAMTVAGCGA
FT                   TQTAKTDLAGGMNGAGAVRNVANTAASSADAAPASSSASHAGTRTAPESANAGRAPNPG
FT                   EMVRSVMQAALRGSLPGVPFADGENIDQVIKAWGSPSSQAYAGSGVYFTYRAKDVAFGL
FT                   NKGEQIFDVRSYAQALRTLTYHEIAGVLGAPGSVRYTQDSYIYLYPAGPDYQLLWVFPR
FT                   LPSGHSGPTVDHVSVFWPQGTVDLMAATQPAPDVVIDRPPSGRGHTVSFHLANAPKGYR
FT                   LEEIEWIPKRGDAVVDTWAQTLARAEAHATAPGFLAYPNQASMVFVYAPWMQGEMGQIR
FT                   VIYQATSGAAMLGNSAWLSLS"
FT                   /protein_id="YP_003183548.1"
     MKDRTEGARR ARDAHERASW KRNWSTWLGL CSTMAIAMTV AGCGATQTAK TDLAGGMNGA        60
     GAVRNVANTA ASSADAAPAS SSASHAGTRT APESANAGRA PNPGEMVRSV MQAALRGSLP       120
     GVPFADGENI DQVIKAWGSP SSQAYAGSGV YFTYRAKDVA FGLNKGEQIF DVRSYAQALR       180
     TLTYHEIAGV LGAPGSVRYT QDSYIYLYPA GPDYQLLWVF PRLPSGHSGP TVDHVSVFWP       240
     QGTVDLMAAT QPAPDVVIDR PPSGRGHTVS FHLANAPKGY RLEEIEWIPK RGDAVVDTWA       300
     QTLARAEAHA TAPGFLAYPN QASMVFVYAP WMQGEMGQIR VIYQATSGAA MLGNSAWLSL       360
     S                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page