(data stored in ACNUC9435 zone)

EMBL: AM039949.PARA

AM039949.PARA        Location/Qualifiers
FT   CDS             18152..18802
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="XCVb0021"
FT                   /product="Plasmid partitioning-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19768"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0G5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19768.1"
FT                   /translation="MKILVLASQKGGAGKTTLAAHLAVAAETAGAGPVVLLDTDPQGSL
FT                   SAWWNSREAQSPALASATLKELPEKLDALAAAGFKLAVIDTPPAIADAIRDVVRLADLV
FT                   LIPTRPSPHDLRAVGSTVDIAQEAGRPFAFAVTQAKPTARITVQAVAALSAHGPVAPAI
FT                   VHDRVDYATSMVDGRTVGEVDARSRSAEEIRTLSAFVNERMHEKKKAKIKETV"
     MKILVLASQK GGAGKTTLAA HLAVAAETAG AGPVVLLDTD PQGSLSAWWN SREAQSPALA        60
     SATLKELPEK LDALAAAGFK LAVIDTPPAI ADAIRDVVRL ADLVLIPTRP SPHDLRAVGS       120
     TVDIAQEAGR PFAFAVTQAK PTARITVQAV AALSAHGPVA PAIVHDRVDY ATSMVDGRTV       180
     GEVDARSRSA EEIRTLSAFV NERMHEKKKA KIKETV                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page