(data stored in ACNUC9435 zone)

EMBL: AM039949.PE1

AM039949.PE1         Location/Qualifiers
FT   CDS             complement(96..443)
FT                   /transl_table=11
FT                   /locus_tag="XCVb0001"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19748"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0G3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19748.1"
FT                   /translation="MPETIKLDTARELAVAGSIRDTVLLGQRGGFLIIFRMGMSERVLA
FT                   TKYGVPRLFSGLDAAAKVLREISITRFQVDASDLVKDDSTRRRRPDRAAALKQTYRDAA
FT                   LVLSRHINDAQ"
     MPETIKLDTA RELAVAGSIR DTVLLGQRGG FLIIFRMGMS ERVLATKYGV PRLFSGLDAA        60
     AKVLREISIT RFQVDASDLV KDDSTRRRRP DRAAALKQTY RDAALVLSRH INDAQ            115
//

If you have problems or comments...

PBIL Back to PBIL home page