(data stored in ACNUC9435 zone)

EMBL: AM039949.PE10

AM039949.PE10        Location/Qualifiers
FT   CDS             complement(7606..7947)
FT                   /transl_table=11
FT                   /locus_tag="XCVb0010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19757"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0F4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19757.1"
FT                   /translation="MATKAMRAMSNRGLSVLAAWKIYLKLLESRNSSYAQTLISHRKLV
FT                   EAMSLPTRDVTAGIDHLVNHSLVHVRQHDVLGSVGHPVNQYNLLGEFRSKPITVSIGGF
FT                   PISTRVAEM"
     MATKAMRAMS NRGLSVLAAW KIYLKLLESR NSSYAQTLIS HRKLVEAMSL PTRDVTAGID        60
     HLVNHSLVHV RQHDVLGSVG HPVNQYNLLG EFRSKPITVS IGGFPISTRV AEM              113
//

If you have problems or comments...

PBIL Back to PBIL home page