(data stored in ACNUC9435 zone)

EMBL: AM039949.PE13

AM039949.PE13        Location/Qualifiers
FT   CDS             complement(9414..10097)
FT                   /transl_table=11
FT                   /locus_tag="XCVb0013"
FT                   /product="putative metal-binding protein, SEC-C motif"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19760"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0F1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19760.1"
FT                   /translation="MGAGHDAQLDRLGDFLEGVGAPAMNLEMLDGFFAALICGPETVLP
FT                   SEYLPQVFGEDHCFDSNDQAAEILGLVMRHWNTIASELFRTLEKDDVYLPVLLEDADGA
FT                   VHGNDWARGFMRGIQLRPNSWQELIGSEEFGGPMLPIMILTHEHDPDPAMRPPEIAPDK
FT                   RDELLQSLIAGLTHIYRYFASHRQLATQGPLRRQGPKIGRNDQCPCGSGRKYKHCCATS
FT                   APTFH"
     MGAGHDAQLD RLGDFLEGVG APAMNLEMLD GFFAALICGP ETVLPSEYLP QVFGEDHCFD        60
     SNDQAAEILG LVMRHWNTIA SELFRTLEKD DVYLPVLLED ADGAVHGNDW ARGFMRGIQL       120
     RPNSWQELIG SEEFGGPMLP IMILTHEHDP DPAMRPPEIA PDKRDELLQS LIAGLTHIYR       180
     YFASHRQLAT QGPLRRQGPK IGRNDQCPCG SGRKYKHCCA TSAPTFH                     227
//

If you have problems or comments...

PBIL Back to PBIL home page