(data stored in ACNUC9435 zone)

EMBL: AM039949.PE2

AM039949.PE2         Location/Qualifiers
FT   CDS             676..2916
FT                   /transl_table=11
FT                   /locus_tag="XCVb0002"
FT                   /product="DotA/TraY family membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19749"
FT                   /db_xref="GOA:Q3C0G2"
FT                   /db_xref="InterPro:IPR027628"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0G2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19749.1"
FT                   /translation="MLKSYGSTFPWAFGRAAAPEKWNPPADDSSLGILREVFGNIVDFV
FT                   IGNGVSAANLSENNTVIASGFEVFNTAILFLAMIFVAYSSIMGVINTAHDGEFLGRKMS
FT                   SIWVPLRTVGGSALLLPLAGGFSLIQIIILWLTLQGVGIGDKAWTAMLGRIDQSGMINH
FT                   PAIPNARPLVANILRSEVCMAAMNKQYAESDRTDRINLVEIKSSRTQMVPTDDLLGGTG
FT                   GNGLGLFGINYKSLTVPVTSWSWAASNGSYIRNDVCGGISWDESSESQAGNARYLDVAK
FT                   ISTAHTAAVRDVILAIRPVAASIVAGQKPNSDVILSTAYAYENKLRQAAKAAVDSGNKA
FT                   SRSAFVDYAKTGGWVFAGSYYNHIISLNDSVQLAVNSLPTSTSIDIQDKESQEALYGFR
FT                   DAMTVTEEFLKHRSQSAAAAYANETRLDTDACKSPTPTGWDEIRTCLSKPALAGIELMA
FT                   ANMTGSNTSHVAQVKAVGDTIMNVAWTQAGVFAIAGGVADAKLVDYSVGSFFSLKGALG
FT                   SVSVLVNTLVLSMLTAGIVLAFYVPMIPFITWTVGVIKWLVSVAEAMVAAPIFAAAHIH
FT                   PDGDEAVGRAGPGYTIILSTVLRPILMLFGLILSIAVAQPIAHFVNAGFMLAVKGSMHD
FT                   SANGLGAFVAYCVIYVIIMTTVLHSVFALIHWIPDNTMRWMGSAVGMGGVGDREEGESH
FT                   QVFAGAARQGRNLTTGPKAPPGGGRMGTEDGPEPPSGGTSESDHAQRPRGGG"
     MLKSYGSTFP WAFGRAAAPE KWNPPADDSS LGILREVFGN IVDFVIGNGV SAANLSENNT        60
     VIASGFEVFN TAILFLAMIF VAYSSIMGVI NTAHDGEFLG RKMSSIWVPL RTVGGSALLL       120
     PLAGGFSLIQ IIILWLTLQG VGIGDKAWTA MLGRIDQSGM INHPAIPNAR PLVANILRSE       180
     VCMAAMNKQY AESDRTDRIN LVEIKSSRTQ MVPTDDLLGG TGGNGLGLFG INYKSLTVPV       240
     TSWSWAASNG SYIRNDVCGG ISWDESSESQ AGNARYLDVA KISTAHTAAV RDVILAIRPV       300
     AASIVAGQKP NSDVILSTAY AYENKLRQAA KAAVDSGNKA SRSAFVDYAK TGGWVFAGSY       360
     YNHIISLNDS VQLAVNSLPT STSIDIQDKE SQEALYGFRD AMTVTEEFLK HRSQSAAAAY       420
     ANETRLDTDA CKSPTPTGWD EIRTCLSKPA LAGIELMAAN MTGSNTSHVA QVKAVGDTIM       480
     NVAWTQAGVF AIAGGVADAK LVDYSVGSFF SLKGALGSVS VLVNTLVLSM LTAGIVLAFY       540
     VPMIPFITWT VGVIKWLVSV AEAMVAAPIF AAAHIHPDGD EAVGRAGPGY TIILSTVLRP       600
     ILMLFGLILS IAVAQPIAHF VNAGFMLAVK GSMHDSANGL GAFVAYCVIY VIIMTTVLHS       660
     VFALIHWIPD NTMRWMGSAV GMGGVGDREE GESHQVFAGA ARQGRNLTTG PKAPPGGGRM       720
     GTEDGPEPPS GGTSESDHAQ RPRGGG                                            746
//

If you have problems or comments...

PBIL Back to PBIL home page