(data stored in ACNUC9435 zone)

EMBL: AM039949.PE22

AM039949.PE22        Location/Qualifiers
FT   CDS             18805..19059
FT                   /transl_table=11
FT                   /locus_tag="XCVb0022"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19769"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0G4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19769.1"
FT                   /translation="MATKKTADLSGLVATKGAAAPVAGMPVRAPAPRSDDTEVANNEPL
FT                   NFRVSGDFRRRFRMFAAAHDMKLNELLRLVFEEYEKKHG"
     MATKKTADLS GLVATKGAAA PVAGMPVRAP APRSDDTEVA NNEPLNFRVS GDFRRRFRMF        60
     AAAHDMKLNE LLRLVFEEYE KKHG                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page