(data stored in ACNUC9435 zone)

EMBL: AM039949.PE3

AM039949.PE3         Location/Qualifiers
FT   CDS             complement(3106..3699)
FT                   /transl_table=11
FT                   /locus_tag="XCVb0003"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19750"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0G1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19750.1"
FT                   /translation="MAPSANTRWPQGTALRTEYFPPVVVKGQRVDLSHLDPLTITFESL
FT                   KVGKALRVAVTFTNHCFSASYGEIPHPPGDAVIWDGRKMRTFCPTRYRLSKVLPDLIRS
FT                   MPEKKVILAAHETTWVHTLTIEDPSGPYHLFLTVKRSSREKRTWQDVDVIVESAYHETR
FT                   NAPTTTGSWRPFVVVCGEAYLANPHKPNKRRHRR"
     MAPSANTRWP QGTALRTEYF PPVVVKGQRV DLSHLDPLTI TFESLKVGKA LRVAVTFTNH        60
     CFSASYGEIP HPPGDAVIWD GRKMRTFCPT RYRLSKVLPD LIRSMPEKKV ILAAHETTWV       120
     HTLTIEDPSG PYHLFLTVKR SSREKRTWQD VDVIVESAYH ETRNAPTTTG SWRPFVVVCG       180
     EAYLANPHKP NKRRHRR                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page