(data stored in ACNUC9435 zone)

EMBL: AM039949.PE4

AM039949.PE4         Location/Qualifiers
FT   CDS             complement(3762..4280)
FT                   /transl_table=11
FT                   /locus_tag="XCVb0004"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19751"
FT                   /db_xref="GOA:Q3C0G0"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR033390"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0G0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19751.1"
FT                   /translation="MRFFLDTEWADPVGSELVSIGLVSEDSHHRFYAERDPLPAMPTDF
FT                   VRHVVYPILQGKPASMSEMAMTTGLRVFLGADQAPLVLADYAHDLVLLRYVLAGFDMPD
FT                   DQAQECGPIPQVQGLLIDGDQIDRKVEWLFENRPMLRARRHHALNDAEALRMAWKLCRA
FT                   EQALDKTGD"
     MRFFLDTEWA DPVGSELVSI GLVSEDSHHR FYAERDPLPA MPTDFVRHVV YPILQGKPAS        60
     MSEMAMTTGL RVFLGADQAP LVLADYAHDL VLLRYVLAGF DMPDDQAQEC GPIPQVQGLL       120
     IDGDQIDRKV EWLFENRPML RARRHHALND AEALRMAWKL CRAEQALDKT GD               172
//

If you have problems or comments...

PBIL Back to PBIL home page