(data stored in ACNUC9435 zone)

EMBL: AM039949.PE5

AM039949.PE5         Location/Qualifiers
FT   CDS             complement(4605..4997)
FT                   /transl_table=11
FT                   /locus_tag="XCVb0005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19752"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0F9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19752.1"
FT                   /translation="MSSWSKNAHPPGCASSGDAGLQPGVACPKPSKKETKMSTEKRNTR
FT                   LTDFTQNDADDDLVLQVCDALEAIVVRLQLRAGAALAAVRSGTLGIEPRRAYDYLLGVF
FT                   HALVFRGEINEDSWWEIDAELDRLAV"
     MSSWSKNAHP PGCASSGDAG LQPGVACPKP SKKETKMSTE KRNTRLTDFT QNDADDDLVL        60
     QVCDALEAIV VRLQLRAGAA LAAVRSGTLG IEPRRAYDYL LGVFHALVFR GEINEDSWWE       120
     IDAELDRLAV                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page