(data stored in ACNUC9435 zone)

EMBL: AM039949.PE7

AM039949.PE7         Location/Qualifiers
FT   CDS             complement(5202..5570)
FT                   /transl_table=11
FT                   /locus_tag="XCVb0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19754"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0F7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19754.1"
FT                   /translation="MPMSQADYQRGLDDQRFYFQQRLNRLIELRDRWIVHARGETARAD
FT                   RLSHELAKAQKHSQASTQQIASLQTKLAAAERTLADLQATSAQRITSLERELEQATENY
FT                   GWIVSVVEDHGVQLRSQP"
     MPMSQADYQR GLDDQRFYFQ QRLNRLIELR DRWIVHARGE TARADRLSHE LAKAQKHSQA        60
     STQQIASLQT KLAAAERTLA DLQATSAQRI TSLERELEQA TENYGWIVSV VEDHGVQLRS       120
     QP                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page