(data stored in ACNUC9435 zone)

EMBL: AM039949.PE8

AM039949.PE8         Location/Qualifiers
FT   CDS             complement(5616..7217)
FT                   /transl_table=11
FT                   /locus_tag="XCVb0008"
FT                   /product="MobA/MobL family plasmid mobilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19755"
FT                   /db_xref="InterPro:IPR005053"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0F6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19755.1"
FT                   /translation="MCGPTGKSEEQKVSVAIFHLCAKVIGRSAGRSATAAAAYRSGTEV
FT                   VDMRTGEVHDYSRRGGVRETFILAPVGSGEWVSDRSALWNAVEAAEKRKDAQLCREVEV
FT                   SLPHELSHDERRRLLVEFCEAEFVALGMVADVAMHSPGHEGDKRNEHAHIMLTMRRVEG
FT                   QGFGQKAREWNSKDLVEQWRSGWAERVNVRLAEHAIQATVDHRSYVRQALAAGHDVESA
FT                   AAPTVHLGPKASAMERRGEQTELGNQNRKVIAFNAQRKVLRRELGQVSAQIIDLEKARS
FT                   DRAARSVVPPRSGVQVRAPRRLGESREAREMREAAERVTEVLMTLLGLGEPPTSHQVRA
FT                   EISRRRPAPMNIRPSGAVLETQALLQVIESKLAKVENRNRALNEDVAKYRDFVALDERV
FT                   AAWREAHPYRARMHDLGVARTDEAEFCGHDLQAAKGRIAELQKELRDEYASLGKAKEEQ
FT                   TVYLAQLQGQAAAQALTSGAPATVELIEQLEQHAAVLEAYERSIAEAAAQVAETAADDK
FT                   NLDDQPDIEHPRPSIN"
     MCGPTGKSEE QKVSVAIFHL CAKVIGRSAG RSATAAAAYR SGTEVVDMRT GEVHDYSRRG        60
     GVRETFILAP VGSGEWVSDR SALWNAVEAA EKRKDAQLCR EVEVSLPHEL SHDERRRLLV       120
     EFCEAEFVAL GMVADVAMHS PGHEGDKRNE HAHIMLTMRR VEGQGFGQKA REWNSKDLVE       180
     QWRSGWAERV NVRLAEHAIQ ATVDHRSYVR QALAAGHDVE SAAAPTVHLG PKASAMERRG       240
     EQTELGNQNR KVIAFNAQRK VLRRELGQVS AQIIDLEKAR SDRAARSVVP PRSGVQVRAP       300
     RRLGESREAR EMREAAERVT EVLMTLLGLG EPPTSHQVRA EISRRRPAPM NIRPSGAVLE       360
     TQALLQVIES KLAKVENRNR ALNEDVAKYR DFVALDERVA AWREAHPYRA RMHDLGVART       420
     DEAEFCGHDL QAAKGRIAEL QKELRDEYAS LGKAKEEQTV YLAQLQGQAA AQALTSGAPA       480
     TVELIEQLEQ HAAVLEAYER SIAEAAAQVA ETAADDKNLD DQPDIEHPRP SIN              533
//

If you have problems or comments...

PBIL Back to PBIL home page