(data stored in ACNUC9435 zone)

EMBL: AM039949.REP

AM039949.REP         Location/Qualifiers
FT   CDS             17396..17899
FT                   /transl_table=11
FT                   /gene="rep"
FT                   /locus_tag="XCVb0019"
FT                   /product="Replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVb0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19766"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0G7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19766.1"
FT                   /translation="MSLPVPSSKKRIEYVQLYRSSMKALRQLALEAPTAHAVLYVLMER
FT                   INERNALVASYATLAKLTGKSRATITRALAELRTRNYIEMVKAGNVSVIVVNKRVAWAT
FT                   ETALRGKLAVFDARVIVSSEEQDEPERLGKEPDLVRLPPVLVPPEMATMLEDGEDDGQG
FT                   DLQL"
     MSLPVPSSKK RIEYVQLYRS SMKALRQLAL EAPTAHAVLY VLMERINERN ALVASYATLA        60
     KLTGKSRATI TRALAELRTR NYIEMVKAGN VSVIVVNKRV AWATETALRG KLAVFDARVI       120
     VSSEEQDEPE RLGKEPDLVR LPPVLVPPEM ATMLEDGEDD GQGDLQL                     167
//

If you have problems or comments...

PBIL Back to PBIL home page