(data stored in ACNUC9435 zone)

EMBL: AM039950.KFRA

AM039950.KFRA        Location/Qualifiers
FT   CDS             4935..5621
FT                   /transl_table=11
FT                   /gene="kfrA"
FT                   /locus_tag="XCVc0007"
FT                   /product="KfrA protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19776"
FT                   /db_xref="InterPro:IPR021104"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0A8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19776.1"
FT                   /translation="MDPSQDARDRILTAADSLYDQAGREVFPTVDAVRKAAKVNMNDAS
FT                   TVMKEWRRMQTRPAVVVQVPEAVQQVASTAVLALWQAAQDAANDALRAAQAGWEAERQE
FT                   ADALSQQMADAYEAQALELEAAQARIAELEAAMQQAVTAAAAHQAAIDQVRTELVDLQQ
FT                   RASTAEARASELRTELDRAHLVAAEQRSAAGQAREDAATLRGRLAAFEGMATSPAPVKA
FT                   APGKGM"
     MDPSQDARDR ILTAADSLYD QAGREVFPTV DAVRKAAKVN MNDASTVMKE WRRMQTRPAV        60
     VVQVPEAVQQ VASTAVLALW QAAQDAANDA LRAAQAGWEA ERQEADALSQ QMADAYEAQA       120
     LELEAAQARI AELEAAMQQA VTAAAAHQAA IDQVRTELVD LQQRASTAEA RASELRTELD       180
     RAHLVAAEQR SAAGQAREDA ATLRGRLAAF EGMATSPAPV KAAPGKGM                    228
//

If you have problems or comments...

PBIL Back to PBIL home page