(data stored in ACNUC9435 zone)

EMBL: AM039950.PE1

AM039950.PE1         Location/Qualifiers
FT   CDS             1242..2060
FT                   /transl_table=11
FT                   /locus_tag="XCVc0001"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19770"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0B4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19770.1"
FT                   /translation="MPAVDTGPHAQGPEPTAPSGRPHKRVHWRQPKPLAGKKRRPGVLD
FT                   ATRHGLVRALEERKGAWKRIRHNVIVAGYALDKALTRVRGLRKDGADSLLAMAVALLYL
FT                   ADVRTGFVGKPRQGGGPWQRYTLPDLAQLAYGGQSDAEQRRARRSLDMMVSLGWAFPTK
FT                   QVRRHTKDADGGDLWCSEAGVRRLNFQRLCDMVGTSRLLKRDRKHADQARGTGVASFTQ
FT                   AQARRQPTQESRTTSRRRDTRPAAHRATGAPPGDAQSAVRHISDILALFN"
     MPAVDTGPHA QGPEPTAPSG RPHKRVHWRQ PKPLAGKKRR PGVLDATRHG LVRALEERKG        60
     AWKRIRHNVI VAGYALDKAL TRVRGLRKDG ADSLLAMAVA LLYLADVRTG FVGKPRQGGG       120
     PWQRYTLPDL AQLAYGGQSD AEQRRARRSL DMMVSLGWAF PTKQVRRHTK DADGGDLWCS       180
     EAGVRRLNFQ RLCDMVGTSR LLKRDRKHAD QARGTGVASF TQAQARRQPT QESRTTSRRR       240
     DTRPAAHRAT GAPPGDAQSA VRHISDILAL FN                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page