(data stored in ACNUC9435 zone)

EMBL: AM039950.PE13

AM039950.PE13        Location/Qualifiers
FT   CDS             complement(10402..11088)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0013"
FT                   /product="putative plasmid stable inheritance protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19782"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0B8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19782.1"
FT                   /translation="MKVAVISFSGNPGKTTLVDHLLAPRMNAPKFEIETINAGSSADTD
FT                   AQRFKGKDYGGLQEDLMTLDSAIVDVGASNVEEFIKQMGQFEGSHEEFDYYVVPTVSEK
FT                   KQQADTLSTIRTLTSLGVPAKKIRVVFNKVELEDANDVPRLFRMIFGLHEETKSFTLRP
FT                   EAVVFKNEIFDRLRTLKKTVSEIVADETDYRAMLREAKDEDAKAHAINMISAGNPPTFS
FT                   GRQKWS"
     MKVAVISFSG NPGKTTLVDH LLAPRMNAPK FEIETINAGS SADTDAQRFK GKDYGGLQED        60
     LMTLDSAIVD VGASNVEEFI KQMGQFEGSH EEFDYYVVPT VSEKKQQADT LSTIRTLTSL       120
     GVPAKKIRVV FNKVELEDAN DVPRLFRMIF GLHEETKSFT LRPEAVVFKN EIFDRLRTLK       180
     KTVSEIVADE TDYRAMLREA KDEDAKAHAI NMISAGNPPT FSGRQKWS                    228
//

If you have problems or comments...

PBIL Back to PBIL home page