(data stored in ACNUC9435 zone)

EMBL: AM039950.PE14

AM039950.PE14        Location/Qualifiers
FT   CDS             complement(11085..11540)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0014"
FT                   /product="putative TraD protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19783"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0B7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19783.1"
FT                   /translation="MTKPDAKQAVRQTEPTTKAAQLREVMPEIEKKLAAGVQLRTIHKA
FT                   LTDAGFDLTFQTLKTYLYRYRKKHQAKTVRQQTESVGSRSAGTPTPASSQSDESVSDET
FT                   YSSEPPTPRGPISMQELDRLMKPDPAKQAQDIARYERLAKQKERSRK"
     MTKPDAKQAV RQTEPTTKAA QLREVMPEIE KKLAAGVQLR TIHKALTDAG FDLTFQTLKT        60
     YLYRYRKKHQ AKTVRQQTES VGSRSAGTPT PASSQSDESV SDETYSSEPP TPRGPISMQE       120
     LDRLMKPDPA KQAQDIARYE RLAKQKERSR K                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page