(data stored in ACNUC9435 zone)

EMBL: AM039950.PE15

AM039950.PE15        Location/Qualifiers
FT   CDS             11929..12324
FT                   /transl_table=11
FT                   /locus_tag="XCVc0015"
FT                   /product="putative TraA protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19784"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0B6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19784.1"
FT                   /translation="MSTAKSVSVWYTEDERIRVEQAAALAGYKHLSKYIRDKSLDRGSH
FT                   RESSRDSMEAWADRQELVGRLAEIERSQKGAHALLAMLLFLVRKKATTGEVNELVLACE
FT                   KSGVPADVLAASLPELAALLTRFTEDS"
     MSTAKSVSVW YTEDERIRVE QAAALAGYKH LSKYIRDKSL DRGSHRESSR DSMEAWADRQ        60
     ELVGRLAEIE RSQKGAHALL AMLLFLVRKK ATTGEVNELV LACEKSGVPA DVLAASLPEL       120
     AALLTRFTED S                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page