(data stored in ACNUC9435 zone)

EMBL: AM039950.PE16

AM039950.PE16        Location/Qualifiers
FT   CDS             12398..12691
FT                   /transl_table=11
FT                   /locus_tag="XCVc0016"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19785"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0B5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19785.1"
FT                   /translation="MSTKAVFTMKLEPELRDTFMAEAAADDRPAAQVVRELMRDYITRR
FT                   REAREYDEFVRRKVQVARKQRDAGLHFSNEEVEADAAARRVDLLRRAGEAGL"
     MSTKAVFTMK LEPELRDTFM AEAAADDRPA AQVVRELMRD YITRRREARE YDEFVRRKVQ        60
     VARKQRDAGL HFSNEEVEAD AAARRVDLLR RAGEAGL                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page