(data stored in ACNUC9435 zone)

EMBL: AM039950.PE17

AM039950.PE17        Location/Qualifiers
FT   CDS             12688..12981
FT                   /transl_table=11
FT                   /locus_tag="XCVc0017"
FT                   /product="putative plasmid stabilisation system protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19786"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0E6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19786.1"
FT                   /translation="MKVRWIAAARQDRADIIDYIAVETPRAALKMDDLFSEAAKRLGEF
FT                   PKLGCTGKIPGTRELIPHESYRLVYEVDEAADTVWVMTLIHTARQWPPARDD"
     MKVRWIAAAR QDRADIIDYI AVETPRAALK MDDLFSEAAK RLGEFPKLGC TGKIPGTREL        60
     IPHESYRLVY EVDEAADTVW VMTLIHTARQ WPPARDD                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page