(data stored in ACNUC9435 zone)

EMBL: AM039950.PE18

AM039950.PE18        Location/Qualifiers
FT   CDS             13094..13714
FT                   /transl_table=11
FT                   /locus_tag="XCVc0018"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19787"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0E5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19787.1"
FT                   /translation="MKLFSAAVIAMSALFVTQAHAQQQPVNTGLGECVDFVIFASSTLT
FT                   GQVNGTTYPFVYGPATYLDKPGSTVYIQNYSCASNDIPGLYSRVSMVSHEMGHLYLDQG
FT                   WVLGTREDYIAKACTNEGRAVLNNSTARNEILDTSQGGADISLIAANAPALLSTIAAGG
FT                   ADLAQRVGDAFCEANVTSTTGENYKVYYGNEYDKLNPPSQEEQ"
     MKLFSAAVIA MSALFVTQAH AQQQPVNTGL GECVDFVIFA SSTLTGQVNG TTYPFVYGPA        60
     TYLDKPGSTV YIQNYSCASN DIPGLYSRVS MVSHEMGHLY LDQGWVLGTR EDYIAKACTN       120
     EGRAVLNNST ARNEILDTSQ GGADISLIAA NAPALLSTIA AGGADLAQRV GDAFCEANVT       180
     STTGENYKVY YGNEYDKLNP PSQEEQ                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page