(data stored in ACNUC9435 zone)

EMBL: AM039950.PE19

AM039950.PE19        Location/Qualifiers
FT   CDS             13718..14254
FT                   /transl_table=11
FT                   /locus_tag="XCVc0019"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19788"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0E4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19788.1"
FT                   /translation="MKTLAAALGALVLATAPLVLAAAVPRASAAAEKQLWAFSEKIALA
FT                   LPGNGKDVLTLVSPRPDSVAMTNGQKTRKPSKQIAPSLFASNAVVVMGADNRADSASFE
FT                   VTGSCVSMASLRKQYPSLIVMDYARGVNEHAVYTLGAQIGDAIVAYSFPASKLDCMSRV
FT                   FITPAKITKNKLGIE"
     MKTLAAALGA LVLATAPLVL AAAVPRASAA AEKQLWAFSE KIALALPGNG KDVLTLVSPR        60
     PDSVAMTNGQ KTRKPSKQIA PSLFASNAVV VMGADNRADS ASFEVTGSCV SMASLRKQYP       120
     SLIVMDYARG VNEHAVYTLG AQIGDAIVAY SFPASKLDCM SRVFITPAKI TKNKLGIE         178
//

If you have problems or comments...

PBIL Back to PBIL home page