(data stored in ACNUC9435 zone)

EMBL: AM039950.PE20

AM039950.PE20        Location/Qualifiers
FT   CDS             14326..14523
FT                   /transl_table=11
FT                   /locus_tag="XCVc0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19789"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0E3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19789.1"
FT                   /translation="MTSGAQTTGQVEAGINAVIAAPTTSRWLKAALADALHRDCVDAAH
FT                   DAELLADLWGRRCDSILGRV"
     MTSGAQTTGQ VEAGINAVIA APTTSRWLKA ALADALHRDC VDAAHDAELL ADLWGRRCDS        60
     ILGRV                                                                    65
//

If you have problems or comments...

PBIL Back to PBIL home page