(data stored in ACNUC9435 zone)

EMBL: AM039950.PE21

AM039950.PE21        Location/Qualifiers
FT   CDS             14527..16101
FT                   /transl_table=11
FT                   /locus_tag="XCVc0021"
FT                   /product="putative TraB protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19790"
FT                   /db_xref="InterPro:IPR019476"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0E2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19790.1"
FT                   /translation="MQKHEAEDATLFFGVSLPIAGWLAGTYAANVPLSPFPQALTAALH
FT                   ATPNNPFMVGGVVAGLGLAATTGYLFHEYGDDGFRGAPYRRWMRGSQMANWHSVKSKVN
FT                   AANRRENRRRRAEQRGAKDLPPIMIGPMPMPLHLENRNTLICASIGAGKSVALESMISS
FT                   AVKRRDKMAVIDPNGTFYSKFSFPGDTILNPFDRRSSGWTLFNEIKGVHDFDRMAKSVI
FT                   PPQIDPSDEQWCAYARDVLADTMRKLVETNNPDQDTLVNLLVREDGEVIRAFLANTDSQ
FT                   GYFRENAEKAIASIQFMMNKYVRPLRFMTKGDFSLHKWVHDPNAGNLFITWREDMRAAQ
FT                   RPLVATWIDTICATILSISDDAQHLSRRLWLFLDELESLGKLESFVPAATKGRKHGLRM
FT                   AASIQDWAQLDETYGKDAAKTLLGCFRNYLIFGASNALNADKASEILGKQHVERIQMTT
FT                   NAGGSGGGGRSRHVVASPPEPVVLDSEISNLKDLEGYVMFAEDFPIAKIKLPYVKYPHR
FT                   AAAIDIK"
     MQKHEAEDAT LFFGVSLPIA GWLAGTYAAN VPLSPFPQAL TAALHATPNN PFMVGGVVAG        60
     LGLAATTGYL FHEYGDDGFR GAPYRRWMRG SQMANWHSVK SKVNAANRRE NRRRRAEQRG       120
     AKDLPPIMIG PMPMPLHLEN RNTLICASIG AGKSVALESM ISSAVKRRDK MAVIDPNGTF       180
     YSKFSFPGDT ILNPFDRRSS GWTLFNEIKG VHDFDRMAKS VIPPQIDPSD EQWCAYARDV       240
     LADTMRKLVE TNNPDQDTLV NLLVREDGEV IRAFLANTDS QGYFRENAEK AIASIQFMMN       300
     KYVRPLRFMT KGDFSLHKWV HDPNAGNLFI TWREDMRAAQ RPLVATWIDT ICATILSISD       360
     DAQHLSRRLW LFLDELESLG KLESFVPAAT KGRKHGLRMA ASIQDWAQLD ETYGKDAAKT       420
     LLGCFRNYLI FGASNALNAD KASEILGKQH VERIQMTTNA GGSGGGGRSR HVVASPPEPV       480
     VLDSEISNLK DLEGYVMFAE DFPIAKIKLP YVKYPHRAAA IDIK                        524
//

If you have problems or comments...

PBIL Back to PBIL home page