(data stored in ACNUC9435 zone)

EMBL: AM039950.PE22

AM039950.PE22        Location/Qualifiers
FT   CDS             16115..19090
FT                   /transl_table=11
FT                   /locus_tag="XCVc0022"
FT                   /product="putative TraI protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19791"
FT                   /db_xref="InterPro:IPR014059"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0E1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19791.1"
FT                   /translation="MLNVTPIRGNNQYAAAHYFSAADDYYAKEHPGEWQGQGAQALGLT
FT                   GPVEQAQLSRLLDGQLPNGERIQTTFDPTDNKKRMGLDLTFSAPKSVSMQALVAGDKDV
FT                   TAAHDRAVTRALEQVERLAEARKKVKGKSYRERTANMVIGKFRHEMSRAKDPQLHTHAV
FT                   VLNMTQRADGAWRALSNEDIFRVQHEVDALYKAELARGLQALGYAIRLVDDQGNFELDH
FT                   ISRDQIEAFSARSRVIEEALANEGKTRATATTLEKQIISLATRPRKDESDRELVKQYWV
FT                   EKSRELGIDYGLRSQLDGRTYEAGDSFGTRGRERGDAGDRIAATSLPASLTPAQAVVQY
FT                   AINHLTEREAVVRETALTATALRRAVGLAGPDEVRAEIKRLAGQGALIEAVPAYRMADR
FT                   KDGPALSSAGWKSYLQELKGWSDKQAQQYVGNAIKQGSLVPAEKRYTTQKALAREKAIL
FT                   AIERTGRGAIEPIMTAAAVKTALEGTALSAGQRSAVETIVSTKNRFVGIQGDAGTGKTY
FT                   TVNQAVALIKQASAVSEGYRTVALAPYGNQVKALKNEGLEAHTLASFLRTKDKPIDGKT
FT                   IIVLDESGVVGARQMEQVMRVVEKAGARMVLLGDTKQTEAIEAGKPFAQLQQDGMQTAR
FT                   ISEIQRQKDHELKTAVEHAAEGRVTPSLAHIKHVEELKEPIERHRAIVNDYIQLTEPER
FT                   RETLIVAGTNEARREINRMVRQSLDLTGKGREFETLTRVDMTQAQRRFAPSYQPGMVIQ
FT                   PEKDDQKAGLTRGETYRVKDALPGNALVLQRQDGTTTTINPRKATQLSVYRLERAELSV
FT                   GDTVRINRNDPGRDLTNGDRMRVAGVIGGVVKLESVEQRDGRPARALELPTNRPLHLEH
FT                   AYASTVHSAQGLTNDRALIALDTNSRTTSMNLYYVAISRACHEARVYTNSVKELPAAIA
FT                   RRFDKTTALAIQRERQLQRRDAGMQPKGAADGKQALQRQQFQQQRKQPASGKKPSEYGR
FT                   FG"
     MLNVTPIRGN NQYAAAHYFS AADDYYAKEH PGEWQGQGAQ ALGLTGPVEQ AQLSRLLDGQ        60
     LPNGERIQTT FDPTDNKKRM GLDLTFSAPK SVSMQALVAG DKDVTAAHDR AVTRALEQVE       120
     RLAEARKKVK GKSYRERTAN MVIGKFRHEM SRAKDPQLHT HAVVLNMTQR ADGAWRALSN       180
     EDIFRVQHEV DALYKAELAR GLQALGYAIR LVDDQGNFEL DHISRDQIEA FSARSRVIEE       240
     ALANEGKTRA TATTLEKQII SLATRPRKDE SDRELVKQYW VEKSRELGID YGLRSQLDGR       300
     TYEAGDSFGT RGRERGDAGD RIAATSLPAS LTPAQAVVQY AINHLTEREA VVRETALTAT       360
     ALRRAVGLAG PDEVRAEIKR LAGQGALIEA VPAYRMADRK DGPALSSAGW KSYLQELKGW       420
     SDKQAQQYVG NAIKQGSLVP AEKRYTTQKA LAREKAILAI ERTGRGAIEP IMTAAAVKTA       480
     LEGTALSAGQ RSAVETIVST KNRFVGIQGD AGTGKTYTVN QAVALIKQAS AVSEGYRTVA       540
     LAPYGNQVKA LKNEGLEAHT LASFLRTKDK PIDGKTIIVL DESGVVGARQ MEQVMRVVEK       600
     AGARMVLLGD TKQTEAIEAG KPFAQLQQDG MQTARISEIQ RQKDHELKTA VEHAAEGRVT       660
     PSLAHIKHVE ELKEPIERHR AIVNDYIQLT EPERRETLIV AGTNEARREI NRMVRQSLDL       720
     TGKGREFETL TRVDMTQAQR RFAPSYQPGM VIQPEKDDQK AGLTRGETYR VKDALPGNAL       780
     VLQRQDGTTT TINPRKATQL SVYRLERAEL SVGDTVRINR NDPGRDLTNG DRMRVAGVIG       840
     GVVKLESVEQ RDGRPARALE LPTNRPLHLE HAYASTVHSA QGLTNDRALI ALDTNSRTTS       900
     MNLYYVAISR ACHEARVYTN SVKELPAAIA RRFDKTTALA IQRERQLQRR DAGMQPKGAA       960
     DGKQALQRQQ FQQQRKQPAS GKKPSEYGRF G                                      991
//

If you have problems or comments...

PBIL Back to PBIL home page